»
«
Offline Showroom in USA
Post Offer Free
MOSINTER GROUP LIMITED
MOSINTER GROUP LIMITED

China CJC-1295 Without DAC CAS 863288-34-0 manufacturer

5th

Gold Index: 88659

You are here: home  > New products  > CJC-1295 Without DAC CAS 863288-34-0

CJC-1295 Without DAC CAS 863288-34-0 

Payment Terms: T/T,L/C,WU 
Place of Origin: Zhejiang, China (Mainland) 
inquire skype
Add to My Favorites
HiSupplier Escrow
Share |

Product Detail

Model No.: MOS 31
Production Capacity: 200KG/MONTH
Delivery Date: within 7 days
CAS: 863288-34-0
Molecular Weight: 0
Brand: MOSINTER
Synonyms 1: CJC-1295 CJC-1295
Means of Transport: Ocean,Land,Air
Packing: As per request of clients
Name: CJC-1295 Without DAC
Molecular Formula: C159H258N46O45
Content: 98%min
Density: 1.45
Synonyms 2: CJC1295

Polypeptide; Peptides; Pharmaceutical raw materials; Peptide; Polypeptide intermediates

Y(D-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;

L-TYROSYL-D-ALANYL-L-ALPHA-ASPARTYL-L-ALANYL-L-ISOLEUCYL-L-PHENYLALANYL-L-THREONYL-L-GLUTAMINYL-L-SERYL-L-TYROSYL-L-ARGINYL-L-LYSYL-L-VALYL-L-LEUCYL-L-ALANYL-L-GLUTAMINYL-L-SERYL-L-ALANYL-L-ARGINYL-L-LYSYL-L-LEUCYL-L-LEUCYL-L-GLUTAMINYL-L-ALPHA-ASPARTYL-L-ISOLEUCYL-L-LEUCYL-L-SERYL-L-ARGINYL-N6-[3-(2,5-DIHYDRO-2,5-DIOXO-1H-PYRROL-1-YL)-1-OXOPROPYL]-L-LYSINAMIDE;


CJC-1295, also known as DAC:GRF (short for drug affinity complex:growth hormone-releasing factor), is a synthetic analogue of growth hormone-releasing hormone (GHRH) (also known as growth hormone-releasing factor (GRF)) and a growth hormone secretagogue (GHS) which was developed by ConjuChem Biotechnologies. It is a modified form of GHRH (1-29) with improved pharmacokinetics, especially in regard to half-life.


CJC-1295 markedly increases plasma growth hormone (GH) and insulin-like growth factor 1 (IGF-1) levels in both animals and humans. With a single injection, in human subjects, CJC-1295 increases plasma GH levels by 2- to 10-fold for 6 days or longer and plasma IGF-1 levels by 1.5- to 3-fold for 9 to 11 days. The drug has an estimated half-life of about 6 to 8 days in humans. With multiple doses of CJC-1295, IGF-1 levels were found to remain elevated in humans for up to 28 days.


CJC-1295 has been shown to extend the half-life and bioavailability of growth-hormone-releasing hormone 1-29 and stimulate insulin-like growth factor 1secretion. It increases the half-life of acting agents by bioconjugation.


CJC-1295 was under investigation for the treatment of lipodystrophy and growth hormone deficiency and reached phase II clinical trials but was discontinued upon the death of one of the trial subjects. The attending physician of the trial believed that the most likely explanation for the incident was that the patient had asymptomatic coronary artery disease with plaque rupture and occlusion, and that the occurrence was unrelated to treatment with CJC-1295. In any case, research was terminated nonetheless as a precaution. CJC-1295 has found black market use for bodybuildingpurposes, with this, in some countries such as the Netherlands, being an illicit use.

bigPhoto
skype Mr. Fedor

Tel: +86-574-89212210
Fax: +86-574-89212215
Mobile: 86- 189 8930 5995
Contact to this supplier

Didn't find what you're looking for? Post Buying Lead or contact HiSupplier Customer Service Center  for help!

Related Search

Find more related products in following catalogs on Hisupplier.com

Other products from this supplier

Company Info

MOSINTER GROUP LIMITED [China (Mainland)]

sgs ico Offline Showroom in USA

Business Type:Manufacturer, Trading Company
City: Ningbo
Province/State: Zhejiang
Country/Region: China (Mainland)

Follow Us: Follow us on facebook Follow us on linkedin

Fedor:   skype

You May Like: